Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MELTLGLVAIASAILIAFGALGTAIGFGLLGGRFLEAVARQPELAPQLQTRMFLIAGLLDAVPMIGVGIGLFFIFANPFVG 1WU0 Chain:A ((2-71)) -----SLGVLAAAIAVGLGALGAGIGNGLIVSRTIEGIARQPELRPVLQTTMFIGVALVEALPIIGVVFSFIYLG------

General information: TITO was launched using: RESULT: Template: 1WU0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 155 -32693 -210.92 -467.04 target 2D structure prediction score : 0.83 Monomeric hydrophicity matching model chain A : 0.82 3D Compatibility (PKB) : -210.92 2D Compatibility (Sec. Struct. Predict.) : 0.83 1D Compatibility (Hydrophobicity) : 0.82 QMean score : 0.555

(partial model without unconserved sides chains): PDB file : Tito_1WU0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1WU0-query.scw PDB file : Tito_Scwrl_1WU0.pdb: