Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAKSFAINMAPTNHGGMIPATQSRTSQEGNLFVRAGDGHMCPKCKCWSVVIKSHDHVIMDGKPVAYVGDKLSCGATIMPQQFHVVGDSGSPYSSAAPVQNSLVEDKSNEIHKVQFKLVDVDTDQPLSAMLYEIHSKES-GK---LLVQGYTDKNGMTAIYESEHTPESVQLITIDLSKPLDPL 3Q1E Chain:D ((13-55)) --------------------------------------------------------------------------------------------------------------------VLNAAQGVPGANMTIVLHRLDPVSSAWNILTTGITNDDGRCPG------------------------

General information: TITO was launched using: RESULT: Template: 3Q1E.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 79 1846 23.36 47.32 target 2D structure prediction score : 0.44 Monomeric hydrophicity matching model chain D : 0.56 3D Compatibility (PKB) : 23.36 2D Compatibility (Sec. Struct. Predict.) : 0.44 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.411

(partial model without unconserved sides chains): PDB file : Tito_3Q1E.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3Q1E-query.scw PDB file : Tito_Scwrl_3Q1E.pdb: