Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MFLKKELKTSIVWENSKFNREKIVENYEEIFFSHFYLSILKIRS----------------------------
2WFG Chain:A ((2-251))GYVGIKIRLTDVAPQAQELFKKESLDVKENKVYLVAATLRPETMYGQTCCFVSPKIDYGVFDAGNGDYFITTERAFKNMSFQNLTPKRGYYKPLFTINGKTLIGSRIDAPYAVNKNLRVLPMETVLATKGTGVVTCVPSDSPDDFVTTRDLANKPEYYGIEKDWVQTDIVPIVHTEKYGDKCAEFLVNDLKIQ-------SPKDSVQLANAKELAYKEGFYNGTMLIGKYKGDKVEDAKPKVKQDLIDEGLAFVYNE


General information:
TITO was launched using:
RESULT:

Template: 2WFG.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 67 4571 68.22 123.53
target 2D structure prediction score : 0.70
Monomeric hydrophicity matching model chain A : 0.52

3D Compatibility (PKB) : 68.22
2D Compatibility (Sec. Struct. Predict.) : 0.70
1D Compatibility (Hydrophobicity) : 0.52
QMean score : 0.248

(partial model without unconserved sides chains):
PDB file : Tito_2WFG.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2WFG-query.scw
PDB file : Tito_Scwrl_2WFG.pdb: