Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence PSDGPEAPEELCFTTIIRRRDGFKYAEKGPIGQKIAFLAGLNCTVQKGCKLACTPAHYGLKYKVSCRPA 5TVO Chain:B ((1-59)) SFEGPEKRLEVIMRVVDGTHVSGLLAHDDDVWQKVIDAICAHIVSREF-------NEYIRSYVLSE---

General information: TITO was launched using: RESULT: Template: 5TVO.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 105 -10107 -96.26 -171.31 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain B : 0.66 3D Compatibility (PKB) : -96.26 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.031

(partial model without unconserved sides chains): PDB file : Tito_5TVO.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5TVO-query.scw PDB file : Tito_Scwrl_5TVO.pdb: