Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHY 5EHR Chain:B ((113-226)) WFHGHLSGKEAEKLLTEKGKHGSFLVRES-SHPGDFVLSVRT-----------SKVTHVMIRCQELKYDVGGGERFDSLTDLVEHY

General information: TITO was launched using: RESULT: Template: 5EHR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 275 -46227 -168.10 -624.69 target 2D structure prediction score : 0.77 Monomeric hydrophicity matching model chain B : 0.98 3D Compatibility (PKB) : -168.10 2D Compatibility (Sec. Struct. Predict.) : 0.77 1D Compatibility (Hydrophobicity) : 0.98 QMean score : 0.929

(partial model without unconserved sides chains): PDB file : Tito_5EHR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5EHR-query.scw PDB file : Tito_Scwrl_5EHR.pdb: