Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLC
1A81 Chain:K ((160-229))WFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTL-


General information:
TITO was launched using:
RESULT:

Template: 1A81.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain K - contact count / total energy / energy per contact / energy per residue : 211 -32272 -152.95 -461.03
target 2D structure prediction score : 0.69
Monomeric hydrophicity matching model chain K : 0.99

3D Compatibility (PKB) : -152.95
2D Compatibility (Sec. Struct. Predict.) : 0.69
1D Compatibility (Hydrophobicity) : 0.99
QMean score : 0.472

(partial model without unconserved sides chains):
PDB file : Tito_1A81.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1A81-query.scw
PDB file : Tito_Scwrl_1A81.pdb: