Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFH 3PQZ Chain:D ((16-97)) WFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEE--RLYFSMDDGQTRFTDLLQLVEFH

General information: TITO was launched using: RESULT: Template: 3PQZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 294 -52618 -178.97 -657.73 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain D : 0.99 3D Compatibility (PKB) : -178.97 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.99 QMean score : 0.707

(partial model without unconserved sides chains): PDB file : Tito_3PQZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3PQZ-query.scw PDB file : Tito_Scwrl_3PQZ.pdb: