Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHY 4LUE Chain:B ((72-178)) WFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRT----GFYISPRSTFSTLQELVDHY

General information: TITO was launched using: RESULT: Template: 4LUE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 283 -34160 -120.71 -432.41 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain B : 0.98 3D Compatibility (PKB) : -120.71 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.98 QMean score : 0.700

(partial model without unconserved sides chains): PDB file : Tito_4LUE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4LUE-query.scw PDB file : Tito_Scwrl_4LUE.pdb: