Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence IMGFVSRSQGRRLLKKTMSGTFLLRFSESS-EGGITCSWVEH-QDDDKVLIYSVQPYTKEVLQSLPLTEIIRHY 1YVL Chain:B ((578-651)) IMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERS-NGGEPDFHAVEPYTKKELSAVTFPDIIRNY

General information: TITO was launched using: RESULT: Template: 1YVL.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 231 -1323 -5.73 -18.63 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain B : 0.88 3D Compatibility (PKB) : -5.73 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.88 QMean score : 0.785

(partial model without unconserved sides chains): PDB file : Tito_1YVL.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1YVL-query.scw PDB file : Tito_Scwrl_1YVL.pdb: