Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYSGNCDRYAVESALLHLQKDGAYTVRPSSGPHGSQPFTLAVLLRGRVFNIPIRRLDGGRHYALGREGRNREELFSSVAAMVQHF 5I6V Chain:B ((6-109)) WFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGD--FTLSVRRNGAVTHIKIQ--NTGDYYDL-----YGGEKFATLAELVQYY

General information: TITO was launched using: RESULT: Template: 5I6V.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 289 -41224 -142.64 -542.42 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain B : 0.74 3D Compatibility (PKB) : -142.64 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.74 QMean score : 0.593

(partial model without unconserved sides chains): PDB file : Tito_5I6V.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5I6V-query.scw PDB file : Tito_Scwrl_5I6V.pdb: