Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQP----DVEGHTSIVDLIEH 4GL9 Chain:H ((30-122)) FYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHH

General information: TITO was launched using: RESULT: Template: 4GL9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 255 -23103 -90.60 -300.03 target 2D structure prediction score : 0.58 Monomeric hydrophicity matching model chain H : 0.81 3D Compatibility (PKB) : -90.60 2D Compatibility (Sec. Struct. Predict.) : 0.58 1D Compatibility (Hydrophobicity) : 0.81 QMean score : 0.532

(partial model without unconserved sides chains): PDB file : Tito_4GL9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4GL9-query.scw PDB file : Tito_Scwrl_4GL9.pdb: