Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIQSITSQGLVLYNRNFREDDKLVKIFTEQVGKRMFFVKHAGQSKLAPVIQPLVLARFLLRINDDGLSYIEDYHEVMTFPKINSDLFVMAYATYVAALADASLQDNQQDAPLFAFLQKTLELMEAGLDYQVLTNIFEIQILTRFGISLNFNECVFCHRVGQAFDFSFKYGTCLCPEHYHEDERRCHLNPNIPYLLNQFQAIDFETLETISLKPGIKQELRQFMDQLYEEYVGIHLKSKKFIDSLADWGQLLKEEKK 3LJU Chain:X ((31-68)) --------------------------------------------------------------------------------------------------------------------------------------------------RPGNARCADCGAPD-PDWASYTLGVFICLSCSGI----------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3LJU.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 101 -18193 -180.13 -551.30 target 2D structure prediction score : 0.39 Monomeric hydrophicity matching model chain X : 0.50 3D Compatibility (PKB) : -180.13 2D Compatibility (Sec. Struct. Predict.) : 0.39 1D Compatibility (Hydrophobicity) : 0.50 QMean score : 0.362

(partial model without unconserved sides chains): PDB file : Tito_3LJU.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3LJU-query.scw PDB file : Tito_Scwrl_3LJU.pdb: