Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNTKKMSQFEIMDTEMLACVEGGGCNWGDFAKAGVGGGAVRGLQLGIKTRTWQGAATGAAGGAILGGVAYAATCWW 5HB6 Chain:B ((9-27)) ----TADDIRAMNRMQRQRVVG------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 5HB6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 15 -2779 -185.23 -154.36 target 2D structure prediction score : 0.44 Monomeric hydrophicity matching model chain B : 0.49 3D Compatibility (PKB) : -185.23 2D Compatibility (Sec. Struct. Predict.) : 0.44 1D Compatibility (Hydrophobicity) : 0.49 QMean score : 0.488

(partial model without unconserved sides chains): PDB file : Tito_5HB6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5HB6-query.scw PDB file : Tito_Scwrl_5HB6.pdb: