Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGDKPISFRDADGNFVSAADVWNEKKLEELFNRLNPNRALRLARTTKENPSQ 3NNC Chain:A ((15-45)) ---------------------WSEKDLRELFEQYGAVYEINVLRDRSQNPPQ

General information: TITO was launched using: RESULT: Template: 3NNC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 39 1621 41.56 52.29 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain A : 0.70 3D Compatibility (PKB) : 41.56 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.612

(partial model without unconserved sides chains): PDB file : Tito_3NNC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3NNC-query.scw PDB file : Tito_Scwrl_3NNC.pdb: