Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFGKILNKFKAWYKGDPGDMRWDPRTDTYVGTREPSKHWTAKVLSYFVDFSLLIAKSIKKHPSAYITQLLAFIAILVSCFSIYLQYYVDDDEYKRCTIAHTNN--QEIALKCKK 3PNW Chain:O ((22-53)) --------------------------------------------------------------------------------DECFALYWEDNKFYRAEVEALHSSGMTAVVKF--

General information: TITO was launched using: RESULT: Template: 3PNW.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain O - contact count / total energy / energy per contact / energy per residue : 60 -9516 -158.59 -317.18 target 2D structure prediction score : 0.60 Monomeric hydrophicity matching model chain O : 0.52 3D Compatibility (PKB) : -158.59 2D Compatibility (Sec. Struct. Predict.) : 0.60 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.480

(partial model without unconserved sides chains): PDB file : Tito_3PNW.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3PNW-query.scw PDB file : Tito_Scwrl_3PNW.pdb: