Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------------MDNSKRPINQIIARINDAAKHGEA-------------LVLTAEEVKILSKDIGDKVFIPVLTNEQVVQLVKEGKLGQKIK------ 2K5R Chain:A ((1-97)) MDRKLLHLLCSPDTRQPLSLLESKGLEALNKAIVSGTVQRADGSIQNQSLHEALITRDRKQVFRIEDS---IPVLLPEEAIATIQIANFPDKLEHHHHHH

General information: TITO was launched using: RESULT: Template: 2K5R.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 136 13544 99.59 211.63 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : 99.59 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.416

(partial model without unconserved sides chains): PDB file : Tito_2K5R.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2K5R-query.scw PDB file : Tito_Scwrl_2K5R.pdb: