Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNEIEMFCELLSLLGLKVVP-KDYQSIDKERVAALLVMSKSWMNRIETVDDLFHDEISCQKEKLGY 1Y10 Chain:C ((79-118)) --DLELLQRVQRAVGLARVDDPDAVVHMRADGEAAARAQ---------------------------

General information: TITO was launched using: RESULT: Template: 1Y10.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 77 -7754 -100.69 -215.38 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain C : 0.61 3D Compatibility (PKB) : -100.69 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 1.009

(partial model without unconserved sides chains): PDB file : Tito_1Y10.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1Y10-query.scw PDB file : Tito_Scwrl_1Y10.pdb: