Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MALLITSDCINCDMCLPECPNTAIFEGNKVYEIDPLRCTECVGFYDAPTCKAVCPI-DCIKQDPAHIENKEQLLEKFKGLNLIGSFSS 2ZVS Chain:C ((1-76)) -ALLITKKCINCDMCEPECPNEAISMGDHIYEINSDKCTECVGHYETPTCQKVCPIPNTIVKDPAHVETEEQLWDKF-----------

General information: TITO was launched using: RESULT: Template: 2ZVS.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 332 -42405 -127.72 -565.39 target 2D structure prediction score : 0.79 Monomeric hydrophicity matching model chain C : 0.82 3D Compatibility (PKB) : -127.72 2D Compatibility (Sec. Struct. Predict.) : 0.79 1D Compatibility (Hydrophobicity) : 0.82 QMean score : 0.277

(partial model without unconserved sides chains): PDB file : Tito_2ZVS.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2ZVS-query.scw PDB file : Tito_Scwrl_2ZVS.pdb: