Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MATKKAGGSTKNGRDSNPKMLGVKVYGGQTVTAGNIIVRQRGTEFHAGANVGMGRDHTLFATADGVVKFEVKGQFGRRYVKVETV 1V8Q Chain:D ((20-84)) -------------------RLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTLFALVDGVVEFQDRGRLG-RYVHVRPL

General information: TITO was launched using: RESULT: Template: 1V8Q.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 298 -34473 -115.68 -530.35 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain D : 0.85 3D Compatibility (PKB) : -115.68 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.85 QMean score : 0.519

(partial model without unconserved sides chains): PDB file : Tito_1V8Q.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1V8Q-query.scw PDB file : Tito_Scwrl_1V8Q.pdb: