Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSVSRII-FAYFPTTAISYKLFATKRGVVTKF-CHNPSFLINGVQ 2D7C Chain:C ((1-42)) VSRDEL-MEAIQKQEEINFRLQDYIDRIIVAIMETNPSIL--EVK

General information: TITO was launched using: RESULT: Template: 2D7C.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 15 -3175 -211.63 -79.36 target 2D structure prediction score : 0.33 Monomeric hydrophicity matching model chain C : 0.64 3D Compatibility (PKB) : -211.63 2D Compatibility (Sec. Struct. Predict.) : 0.33 1D Compatibility (Hydrophobicity) : 0.64 QMean score : -0.005

(partial model without unconserved sides chains): PDB file : Tito_2D7C.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2D7C-query.scw PDB file : Tito_Scwrl_2D7C.pdb: