Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGYDKHQARTSGWRVPENNLIFVSLLGGGLGGLISRKVFHHKTRKKKFTIGFAAGVLVDLILIYFFH 4JU0 Chain:D ((12-31)) --------------------------GGWTGMVDGWYGYHHQNEQG---------------------

General information: TITO was launched using: RESULT: Template: 4JU0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 11 -586 -53.23 -29.28 target 2D structure prediction score : 0.25 Monomeric hydrophicity matching model chain D : 0.48 3D Compatibility (PKB) : -53.23 2D Compatibility (Sec. Struct. Predict.) : 0.25 1D Compatibility (Hydrophobicity) : 0.48 QMean score : 0.397

(partial model without unconserved sides chains): PDB file : Tito_4JU0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4JU0-query.scw PDB file : Tito_Scwrl_4JU0.pdb: