Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLEYSGFFIKAVTLKKDIIIVLFFLLLLIGRFILIHYSPLPIIKEKTGSGCSNYMLRKKNP 2MPG Chain:A ((1-21)) ----------------------------------------GIVEQCCTSICSLYQLENYCN

General information: TITO was launched using: RESULT: Template: 2MPG.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 23 -2488 -108.17 -118.48 target 2D structure prediction score : 0.19 Monomeric hydrophicity matching model chain A : 0.43 3D Compatibility (PKB) : -108.17 2D Compatibility (Sec. Struct. Predict.) : 0.19 1D Compatibility (Hydrophobicity) : 0.43 QMean score : 0.449

(partial model without unconserved sides chains): PDB file : Tito_2MPG.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2MPG-query.scw PDB file : Tito_Scwrl_2MPG.pdb: