Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGAITIVAVYQAFLKYPDYGTKLLSLTHNQTAYSPTLILSTLTAGAKSATYFFHKTTSMLKRKKQRKQLLVVVAAMIIIYFLPVITQVFHQYFG 1EHK Chain:C ((1-33)) -----------------------------------------------------------EEKPKGALAVILVLTLTILVFWLGVYAVFFARG--

General information: TITO was launched using: RESULT: Template: 1EHK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 6 549 91.50 16.64 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain C : 0.53 3D Compatibility (PKB) : 91.50 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.350

(partial model without unconserved sides chains): PDB file : Tito_1EHK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1EHK-query.scw PDB file : Tito_Scwrl_1EHK.pdb: