Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKVKEIRELTTAEMLDQEKQLKEELFNLRFQLATGQLENTARIKEVRKSIARIKTVLREQAK---- 1R73 Chain:A ((1-66)) MKASELRNYTDEELKNLLEEKKRQLMELRFQLAMGQLKNTSLIKLTKRDIARIKTILRERELGIRR

General information: TITO was launched using: RESULT: Template: 1R73.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 141 -8673 -61.51 -139.89 target 2D structure prediction score : 0.77 Monomeric hydrophicity matching model chain A : 0.81 3D Compatibility (PKB) : -61.51 2D Compatibility (Sec. Struct. Predict.) : 0.77 1D Compatibility (Hydrophobicity) : 0.81 QMean score : 0.804

(partial model without unconserved sides chains): PDB file : Tito_1R73.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1R73-query.scw PDB file : Tito_Scwrl_1R73.pdb: