Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--MNILYISISGNTRAFAKHLAEYAEKMHAEDPVNPEVTLKEIHENSDFTKETEPFFTFVPTYLDGGNGLDNGDTEILTETMREYLEHEDNHKLCLGVVGSGNKNFNNQYCLTAKQYAQTFGFPFLADYELRGTPSDVTRIYQILAENNK---
4N82 Chain:B ((22-174))TKVSLVYISLSGNTESFVRRLTDYLLEQHPSLEVEKIHIKDLVKERQPFFEMDNPFIAFLPTYLEGGNGVDNGDVEILTTDVGDFIAYGQNASKCLGVIGSGNRNFNNQYCLTAKQYSERFGFPVLADFEMRGMLGDIKKVAGIIEELYHIEK


General information:
TITO was launched using:
RESULT:

Template: 4N82.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 705 21085 29.91 142.46
target 2D structure prediction score : 0.68
Monomeric hydrophicity matching model chain B : 0.83

3D Compatibility (PKB) : 29.91
2D Compatibility (Sec. Struct. Predict.) : 0.68
1D Compatibility (Hydrophobicity) : 0.83
QMean score : 0.559

(partial model without unconserved sides chains):
PDB file : Tito_4N82.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4N82-query.scw
PDB file : Tito_Scwrl_4N82.pdb: