Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMFKGVLFDLDGVITDTAEFHYRAWRKLGQEIGIT-IDHTFNEQLKGVSREDSLSLLLAYGGKEHSFSKEEFAELAKRKNDYYLEMIQTIEPKDVFPGVVPLLDSLKEEKIKIALASASKNGPFLLEKMGLTPYFDAIADPAEATNGKPAPDIFLLAAKAVGLKAEECIGIEDAQAGIQAILSSGAQPIGVGRAEDLGEEIPLVPDTTFLTIDYLKEKWHDHG
1Z4O Chain:B ((1-216))MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADK------EEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVW----


General information:
TITO was launched using:
RESULT:

Template: 1Z4O.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 1103 4057 3.68 19.23
target 2D structure prediction score : 0.64
Monomeric hydrophicity matching model chain B : 0.91

3D Compatibility (PKB) : 3.68
2D Compatibility (Sec. Struct. Predict.) : 0.64
1D Compatibility (Hydrophobicity) : 0.91
QMean score : 0.659

(partial model without unconserved sides chains):
PDB file : Tito_1Z4O.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1Z4O-query.scw
PDB file : Tito_Scwrl_1Z4O.pdb: