Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKVEEGQREKLKTEMERLHTYITQLSQTFYDPDKEKVMVNYPNNSEGRQLEQVYHEVFKHLLTVKKELDYYSLPIIDTGILKYDGKKERFIFKSV--REDLPLSAGMDLEVLVEDYFTEEKHWVRTKLD-YLPQAAGGTQASGWYITEDKELELEGVMARIRKKN 3NRL Chain:A ((5-72)) ----------------------------------------------------------------------------REGTLFYDTETGRYDIRFDLESFYGGLHCGECFDVKVKD------VWVPVRIEMG----------DDWYLVGLNVSRLDGLRVR-----

General information: TITO was launched using: RESULT: Template: 3NRL.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 220 -12946 -58.85 -199.17 target 2D structure prediction score : 0.28 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -58.85 2D Compatibility (Sec. Struct. Predict.) : 0.28 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.389

(partial model without unconserved sides chains): PDB file : Tito_3NRL.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3NRL-query.scw PDB file : Tito_Scwrl_3NRL.pdb: