Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNKGLKIIGVIMSLLLLSVFLAIALINAPYIMPEQLERFRFFTLTNYYMQQYIFWAAVVFAVLAIIILLVVLFYPKSRGTFVMKREDGKLTIDKKAIEGLVRSHLHEE--EFIHSP-KVRIRSTKNRIHIHVNGDLKRTSSLVGKTGVLMQDIEEEVTKVLGTKETVKVAVTYSGYEEQEDTRDYKHSRVE 3BYR Chain:A ((15-91)) ----------------------------------------------------------------------------------------------------IRAFLQERIRGRALEVHDLKTRRAGPRSFLEFHLVVRGDTPVEEA-HRLCDELERALAQAFPG---LQATIHVEPEGERKR----------

General information: TITO was launched using: RESULT: Template: 3BYR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 274 15920 58.10 215.13 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain A : 0.53 3D Compatibility (PKB) : 58.10 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.531

(partial model without unconserved sides chains): PDB file : Tito_3BYR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3BYR-query.scw PDB file : Tito_Scwrl_3BYR.pdb: