Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGDPVEQLVRHFLIETGPKGVKIKGCPSEPYFGSLSALVSQH 3EAZ Chain:A ((82-156)) WFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSS---------------DGKVEHYRIMYHASKLSID---EEVYFENLMQLVEHY

General information: TITO was launched using: RESULT: Template: 3EAZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 272 -48613 -178.72 -648.17 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain A : 0.72 3D Compatibility (PKB) : -178.72 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.466

(partial model without unconserved sides chains): PDB file : Tito_3EAZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3EAZ-query.scw PDB file : Tito_Scwrl_3EAZ.pdb: