Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGDPVEQLVRHFLIETGPKGVKIKGCPSEPYFGSLSALVSQH 2CRH Chain:A ((28-102)) WYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKY---------------NVEVKHIKIMTAEGLYRIT---EKKAFRGLTELVEFY

General information: TITO was launched using: RESULT: Template: 2CRH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 282 -42298 -149.99 -563.97 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -149.99 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.427

(partial model without unconserved sides chains): PDB file : Tito_2CRH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2CRH-query.scw PDB file : Tito_Scwrl_2CRH.pdb: