Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------------PATPAPSKPAAVLPQLCKVEMFDNNARFVGMARGNWDKD-----------FVIKGHTIKCNTRCETKDVVLPKNWSVKGYMIKV- 1FLT Chain:X ((132-226)) GRPFVEMYSEIPEIIHMTEGRELVIP--CRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQT

General information: TITO was launched using: RESULT: Template: 1FLT.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 196 5157 26.31 72.63 target 2D structure prediction score : 0.28 Monomeric hydrophicity matching model chain X : 0.60 3D Compatibility (PKB) : 26.31 2D Compatibility (Sec. Struct. Predict.) : 0.28 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.181

(partial model without unconserved sides chains): PDB file : Tito_1FLT.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1FLT-query.scw PDB file : Tito_Scwrl_1FLT.pdb: