Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence FVQCNHHLLYN-GRHWGT-IRKKAGWAVRFYEEKPGQPKR--LVAICKNASPVHCNYLKCTNLAAGFSAGTSTDVLSSGTVGSIGNDPQAQRQ 4EPD Chain:B ((42-84)) FAEVNPALKFDRQQAAGYRLNIPAGTAVRF---EPGQKREVELVAF-----------------------------------------------

General information: TITO was launched using: RESULT: Template: 4EPD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 69 -12798 -185.48 -328.15 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain B : 0.67 3D Compatibility (PKB) : -185.48 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.348

(partial model without unconserved sides chains): PDB file : Tito_4EPD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4EPD-query.scw PDB file : Tito_Scwrl_4EPD.pdb: