Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMTQFVHYQNKQPRDNRRNVNLNDSETMLFDAMSRITGTPIAIIIREFALRHAIRLIMDTDQSILDRIMNTGAPEHLQRG 1EA4 Chain:F ((3-38)) ---------------KRLTITLSESVLENLEKMAREMGLSKSAMISVALEN-----------------------------

General information: TITO was launched using: RESULT: Template: 1EA4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 61 -10253 -168.08 -284.81 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain F : 0.59 3D Compatibility (PKB) : -168.08 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.498

(partial model without unconserved sides chains): PDB file : Tito_1EA4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1EA4-query.scw PDB file : Tito_Scwrl_1EA4.pdb: