Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceKSYKAQKICHFTILKMYKNTWTFVRKDSAPADQ-TT---TIEGIKVFFSKDCIP--QHDYRGLY----------IEYNGFHHDVSQS
5D67 Chain:A ((1-86))-GATADRDILARLHKAVTSHYHAITQEFENFDTMKTNTISREEFRAICNRRVQILTDEQFGRLWNEMPVNAKGRLKYPDFLSRFSSE


General information:
TITO was launched using:
RESULT:

Template: 5D67.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 158 5480 34.68 78.29
target 2D structure prediction score : 0.43
Monomeric hydrophicity matching model chain A : 0.67

3D Compatibility (PKB) : 34.68
2D Compatibility (Sec. Struct. Predict.) : 0.43
1D Compatibility (Hydrophobicity) : 0.67
QMean score : 0.208

(partial model without unconserved sides chains):
PDB file : Tito_5D67.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5D67-query.scw
PDB file : Tito_Scwrl_5D67.pdb: