Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------PEGTVAL---QARYPANNKKAGKVNAAANNGTAAGGNVNGTAD-----FGKCKPTMSFKTGRPGRKAT-EGTFLPDDELVAKGQQDALNPNIITNRIC--DQLTNVCSANAAAKTQCAAAKAMVSSLGTKDSSTADAFNKALGF
5IVA Chain:B ((3-154))NTSGFQLRGLGDAQFALKEIDVSARNAYGPTVRELKETLENSGVKVTSNAPYHLVLVREDNQQRTVSYTGSARGAEFELTNTINYEIVGANDLVLMSNQVQVQKVYVHDENNLIGSDQEAAQLRSEMRRDLIQQLSMRLQALTPAQLDEAQR


General information:
TITO was launched using:
RESULT:

Template: 5IVA.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 424 34089 80.40 256.31
target 2D structure prediction score : 0.41
Monomeric hydrophicity matching model chain B : 0.66

3D Compatibility (PKB) : 80.40
2D Compatibility (Sec. Struct. Predict.) : 0.41
1D Compatibility (Hydrophobicity) : 0.66
QMean score : 0.286

(partial model without unconserved sides chains):
PDB file : Tito_5IVA.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5IVA-query.scw
PDB file : Tito_Scwrl_5IVA.pdb: