Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------GCQIELLNI----NQQVVDSVCIPHDGVRPMRDATAPKGVINYAVK------VNSSCGAGLAAGNLANGASLRNAGPY 4RS8 Chain:A ((9-92)) YIFLTPRAYIIVHLLKVGKAKASEISENTQIPYQTVIQNIRWLLAEGYVVKEQKGEEIYYKLTDKGKQMATAELEKIRKLVEVV--

General information: TITO was launched using: RESULT: Template: 4RS8.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 226 3927 17.37 59.49 target 2D structure prediction score : 0.33 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : 17.37 2D Compatibility (Sec. Struct. Predict.) : 0.33 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.141

(partial model without unconserved sides chains): PDB file : Tito_4RS8.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4RS8-query.scw PDB file : Tito_Scwrl_4RS8.pdb: