Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceCFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFY
3PQZ Chain:C ((17-97))-FHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEE-RLYFSMDDGQTRFTDLLQLVEFH


General information:
TITO was launched using:
RESULT:

Template: 3PQZ.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 290 -48328 -166.65 -604.10
target 2D structure prediction score : 0.83
Monomeric hydrophicity matching model chain C : 0.92

3D Compatibility (PKB) : -166.65
2D Compatibility (Sec. Struct. Predict.) : 0.83
1D Compatibility (Hydrophobicity) : 0.92
QMean score : 0.693

(partial model without unconserved sides chains):
PDB file : Tito_3PQZ.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3PQZ-query.scw
PDB file : Tito_Scwrl_3PQZ.pdb: