Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQP----DVEGHTSIVDLIEH 4GL9 Chain:G ((30-122)) FYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHH

General information: TITO was launched using: RESULT: Template: 4GL9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 254 -24370 -95.94 -316.49 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain G : 0.81 3D Compatibility (PKB) : -95.94 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.81 QMean score : 0.521

(partial model without unconserved sides chains): PDB file : Tito_4GL9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4GL9-query.scw PDB file : Tito_Scwrl_4GL9.pdb: