Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIYKVFYQETKERSPRRETTRTLYLDIDASSELEGRITARQLVEENRPEYNIEYIELLSDKLLDYEKETGAFEITEF 3VOQ Chain:A ((452-473)) -IFKLTYLSNH-------DYKHLYFESDAA-----------------------------------------------

General information: TITO was launched using: RESULT: Template: 3VOQ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 29 -4658 -160.60 -211.70 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -160.60 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.676

(partial model without unconserved sides chains): PDB file : Tito_3VOQ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3VOQ-query.scw PDB file : Tito_Scwrl_3VOQ.pdb: