Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTNFNSNEKFCGKSLKSLSADEMSLIYGASDGAEPRWTPTPIILKSAAASSKVCISAAVSGIGGLVSYNNDCLG 1JO6 Chain:A ((1-45)) MFIWTS-----GRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGED------------------------

General information: TITO was launched using: RESULT: Template: 1JO6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 20 924 46.20 20.53 target 2D structure prediction score : 0.44 Monomeric hydrophicity matching model chain A : 0.57 3D Compatibility (PKB) : 46.20 2D Compatibility (Sec. Struct. Predict.) : 0.44 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.231

(partial model without unconserved sides chains): PDB file : Tito_1JO6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1JO6-query.scw PDB file : Tito_Scwrl_1JO6.pdb: