Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSTTSSATTPIEINALGQPCPMPLLMLKRELKKLSGKQLFLLKSSDPHSEIDVTRYCQLHHFTCQTMQIS-EREFHYLIETQ 1JDQ Chain:A ((19-98)) --HMAKYQVTKTLDVRGEVCPVPDVETKRALQNMKPGEILEVWIDYPMSKERIPETVKKLGHEVLEIEEVGPSEWKIYIKVK

General information: TITO was launched using: RESULT: Template: 1JDQ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 260 -9972 -38.35 -126.23 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : -38.35 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.398

(partial model without unconserved sides chains): PDB file : Tito_1JDQ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1JDQ-query.scw PDB file : Tito_Scwrl_1JDQ.pdb: