Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRIIKEPVMSEFEGKSGKWAWEIQKEQQANLDELRSSIEYLVQKYKHDAHASSIFGDQDKTRIYNRFVNQLEHLLKGDA 4M3L Chain:A ((1-60)) --GAMDTLYAILDEKKSELLQRITQEQEEKLSFIEA----LIQQYQEQLDKSTKLVETAIQSLDEP-------------

General information: TITO was launched using: RESULT: Template: 4M3L.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 2 -154 -76.75 -2.56 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -76.75 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.286

(partial model without unconserved sides chains): PDB file : Tito_4M3L.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4M3L-query.scw PDB file : Tito_Scwrl_4M3L.pdb: