Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTDINDYEDAEDSAVDEDEAKAAESGAADEEAGNLTDADLAEAETLTVTAKQKQRQALEDEVAAFLARGGRITEVPPDEHSDR 5FMR Chain:B ((71-109)) ----------------------------------------------------KFTAPEVDMLKKFVKNGGSILI---------

General information: TITO was launched using: RESULT: Template: 5FMR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 18 -3795 -210.81 -172.48 target 2D structure prediction score : 0.77 Monomeric hydrophicity matching model chain B : 0.64 3D Compatibility (PKB) : -210.81 2D Compatibility (Sec. Struct. Predict.) : 0.77 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.940

(partial model without unconserved sides chains): PDB file : Tito_5FMR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5FMR-query.scw PDB file : Tito_Scwrl_5FMR.pdb: