Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------MKLEQKIIDLLCEIPDNVDYTDVAEDLDLEDISEIRIKQLRELLTNSDIYTISSC-----------------
1XMK Chain:A ((1-79))GSHMASLDMAEIKEKICDYLFN-VSDSSALNLAKNIGLTKARDIN-AVLIDMERQGDVYRQGTTPPIWHLTDKKRERMQIK


General information:
TITO was launched using:
RESULT:

Template: 1XMK.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 138 6249 45.28 117.91
target 2D structure prediction score : 0.85
Monomeric hydrophicity matching model chain A : 0.69

3D Compatibility (PKB) : 45.28
2D Compatibility (Sec. Struct. Predict.) : 0.85
1D Compatibility (Hydrophobicity) : 0.69
QMean score : 0.787

(partial model without unconserved sides chains):
PDB file : Tito_1XMK.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1XMK-query.scw
PDB file : Tito_Scwrl_1XMK.pdb: