Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSFWQKLFLADQQHNEHKNQTACVENDCSCKTNEQLLSALAQATDEDVIKGIKKVLISRGYSRKELNELTQKTSIH 2OO9 Chain:C ((864-874)) -------------------------------------------------------LMSQGYSYQDI----------

General information: TITO was launched using: RESULT: Template: 2OO9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 10 -3227 -322.65 -293.32 target 2D structure prediction score : 0.36 Monomeric hydrophicity matching model chain C : 0.66 3D Compatibility (PKB) : -322.65 2D Compatibility (Sec. Struct. Predict.) : 0.36 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 1.425

(partial model without unconserved sides chains): PDB file : Tito_2OO9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2OO9-query.scw PDB file : Tito_Scwrl_2OO9.pdb: