Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAIQRSGRFERIKKPLKSDMNVVPYIDVMLVLLVIFMVTAPMITSGIKVDLPQANNHPIESKDMPAMVTIGKDGNIYLQYEDYKDNEPLSLEKLESVLSEAQKKAEQ-ENKQLTVLVNGDKTRPYGEVVSLMA-SLQEAGLTQVGLLTEPLK 2JVF Chain:A ((26-81)) --------------------------------------------------------------------------------------------ELERALQELEKALARAGARNVQITISAENDEQAKELLELIARLLQKLGYKDINVRV----

General information: TITO was launched using: RESULT: Template: 2JVF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 84 4135 49.22 76.56 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : 49.22 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.620

(partial model without unconserved sides chains): PDB file : Tito_2JVF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2JVF-query.scw PDB file : Tito_Scwrl_2JVF.pdb: