Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTDIAEITQRDREKIKEYVESSKFLTYTMLAERFGISKSYLSLILNGKKTSAEANRIIDSIITMYEL 4I6R Chain:A ((12-65)) ----------VSFVIKKIRLEKG-MTQEDLAYKSNLDRTYISGIERNSRNLTI--KSLELIMKGLEV

General information: TITO was launched using: RESULT: Template: 4I6R.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 176 -29346 -166.74 -543.44 target 2D structure prediction score : 0.91 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -166.74 2D Compatibility (Sec. Struct. Predict.) : 0.91 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.861

(partial model without unconserved sides chains): PDB file : Tito_4I6R.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4I6R-query.scw PDB file : Tito_Scwrl_4I6R.pdb: