Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKNKFENRSDTRCGSFLYILYEVFFIPYEKISLKIKKDENKRFSIKRRPFIFCLYLCEKRKRAQHIKLLLIVCLL 4H13 Chain:E ((1-32)) -----------------MILGAVFYIVF--IALFFGIAVGIIFAIKSIKLI------------------------

General information: TITO was launched using: RESULT: Template: 4H13.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain E - contact count / total energy / energy per contact / energy per residue : 22 -5181 -235.50 -161.91 target 2D structure prediction score : 0.38 Monomeric hydrophicity matching model chain E : 0.59 3D Compatibility (PKB) : -235.50 2D Compatibility (Sec. Struct. Predict.) : 0.38 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.180

(partial model without unconserved sides chains): PDB file : Tito_4H13.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4H13-query.scw PDB file : Tito_Scwrl_4H13.pdb: