Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLEYSGFFIKAVTLKKDIIIVLFFLLLLIGRFILIHYSPLPIIKEKTGSGCSNYMLRKKNP 4F8F Chain:A ((1-21)) ----------------------------------------GIVEQCCTSICSLYQLENYCN

General information: TITO was launched using: RESULT: Template: 4F8F.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 29 -1546 -53.31 -73.62 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain A : 0.43 3D Compatibility (PKB) : -53.31 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.43 QMean score : 0.655

(partial model without unconserved sides chains): PDB file : Tito_4F8F.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4F8F-query.scw PDB file : Tito_Scwrl_4F8F.pdb: