Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFY 1NRV Chain:A ((435-516)) WFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPC-----TFFSLDDGNTKFSDLIQLVDFY

General information: TITO was launched using: RESULT: Template: 1NRV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 280 -55080 -196.71 -715.32 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain A : 0.95 3D Compatibility (PKB) : -196.71 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.95 QMean score : 0.693

(partial model without unconserved sides chains): PDB file : Tito_1NRV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1NRV-query.scw PDB file : Tito_Scwrl_1NRV.pdb: